Are you looking for the perfect peptide? But lacking knowledge on what to get? Call off the search and browse our top-quality Peptides! Benefits include muscle, strength, weight loss, anti-ageing and more! If high-quality peptides are what you're looking for, you’ve come to the right place!
Peptides Vials
-
- Vials
- Ace-031 Peptide Vial 1mg
- £79.00
- ACE-031 or popularly called as ACVR2B is a soluble type of the active form IIB receptor, myostatin inhibitor and other proteins which restrict the growth of the muscle.
- Add to cart
-
- Sale!
- Vials
- Aicar Peptide Vial 50mg
-
£17.99£12.99 - Molecular Formula: C9H15N4O8P Molecular Weight: 338.21 g/mol Purity: 99% Sequence: 5-Aminoimidazole-4-carboxamide ribonucleotide
- Add to cart
-
- Vials
- AMPK Peptide Vial 10mg
- £19.99
- Vial Size 10mg AMPK promotes the energy-generating processes, such as fat oxidation and glucose uptake.
- Add to cart
-
- Sale!
- AOD, Promotion, Vials
- AOD-9604 Peptide Vial
- £11.99 – £60.99
- Sequence: Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser-Val-Glu-Gly-Ser Cys Gly Phe-Tyr Molecular Formula: C78H123N23O23S2 Molecular Weight: 1817.116
- Select options
-
- Sale!
- Blend Peptide Vials, BPC-157, Healing, Injury Recovery, TB500, Vials
- BPC157 and TB500 Blend 20mg
-
£61.99£46.99 - TB500= 10mg BPC157 Blend = 10mg
- Add to cart
-
- BPC-157, Vials
- BPC157 Peptide Vial
- £7.99 – £32.99
- Comes in size 2mg & 5mg Sequence: Gly- Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ma Asp-Asp Ala Gly Leu Val Molecular Formula: C62H98N16O22 Molecular Weight: 1419.556
- Select options
-
- Sale!
- CJC-1295 Dac, Promotion, Vials
- CJC-1295 DAC Vial
- £17.99 – £75.99
- Sequence: Tyr 0 Ala Asp-Ala Ile-Phe-Thr Gln-Ser Tyr Arg-Lys Val Leu-Ala Gln Lou Ser-Ala Aro Lys Leu Leu Gln Asp-Ile-Leu-Ser-Arg Molecular Formula: C152 H252 N44 042 Molecular Weight:3357.954
- Select options
-
- Sale!
- CJC1296 NO-DAC, Promotion, Vials
- CJC-1295 No DAC Vial
- £9.99 – £35.99
- Sequence: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg–NH2 Molecular Formula: C152H252N44O42 Molecular Weight: 3367.97
- Select options
-
- Sale!
- Promotion, Vials
- DSIP Peptide Vial
- £17.99 – £48.99
- Sequence: Trp-Ala Gly Gly AspAla-Ser-Gly-Glu Molecular Formula: C35H48N10O15 Molecular Weight: 848.824 g·mol−1
- Select options
-
- EPITHALON, Vials
- Epithalon Peptide Vial
- £15.99 – £120.00
- Vial Comes in sizes - 10mg & 100mg Molecular Formula: C14H22N4O9 Molecular Weight: 390.349
- Select options
-
- Vials
- Follistatin 315 Peptide Vial 1mg
- £66.99
- This Vial Contains 1mg Research has suggested Follistatin is a glycoprotein, meaning that the compound contains sugars and proteins. It is naturally-occurring and produced in different forms that play distinct roles in the body.
- Add to cart
-
- Sale!
- Promotion, Vials
- Follistatin 344 Peptide Vial 1mg
-
£84.99£63.99 - Molecular Weight: 3780 g/mol
- Add to cart
-
- Vials
- FOXO4-DRI Peptide Vial 10mg
- £194.99
- This Vial Contains 10mg Purity: >98% Molecular Formula: C228H388N86O64 Molecular Weight: 5358.05 g/mol Sequence: H-LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG-OH
- Add to cart
-
- Vials
- FTPP (Adipotide) Peptide Vial
- £29.99 – £116.99
- Sequence: CKGGRAKDC-GG-D(KLAKLAK)2
- Select options
-
- Sale!
- Vials
- GDF-8 Peptide Vial 1mg
-
£83.99£62.99 - 1 x GDF-8 = 1 mg Myostatin or GDF-8 has been able to improve your muscle. It also plays a vital role in the regeneration of the bone using the blocking of active myostatin which is made by a recombinant. Inhibitors of myostatin enhance the repair of wounds once you happen to have deep penetrates injuries to your muscles as…
- Add to cart
-
- Sale!
- Promotion, Vials
- GHK-Cu Peptide Vial
- £15.99 – £60.00
- Sequence: Gly-His-Lys Molecular Formula: C28H52CuN12O8 Molecular Weight: 748.346 g/mol Purity: >98%
- Select options
Useful Articles
-
SNAP-8 – Botox In A BottleFebruary 15, 2021/0 Comments -
TB500 – Benefits Of The Healing & Repairing Peptide {name}November 2, 2020/ -
SARMs Liquid vs CapsulesOctober 29, 2020/ -
Boost Your Immune System!October 9, 2019/ -
Melanotan 1 or Melanotan 2 – Which one?September 23, 2019/ -
Which is Safer Between MT-1 and MT-2 for Your Tanning Needs?September 20, 2019/ -
Direct Sarms Worldwide ServiceAugust 20, 2019/ -
Oxytocin Love Hormone OverviewJune 19, 2019/ -
SARMs And Weight LossJune 17, 2019/